PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00065204001
Common NameGSBRNA2T00065204001, LOC106414381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 354aa    MW: 39424.1 Da    PI: 6.4424
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00065204001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.13e-31195249155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr+rW+peLH++F+eav++L G+ekAtPk+++++m+v+gLt+++vkSHLQkYR+
  GSBRNA2T00065204001 195 KPRMRWSPELHDCFLEAVKKLDGPEKATPKAVMKMMSVEGLTIYQVKSHLQKYRI 249
                          79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.904192252IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-29193250IPR009057Homeodomain-like
SuperFamilySSF466891.54E-17194250IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-25195250IPR006447Myb domain, plants
PfamPF002491.4E-9197248IPR001005SANT/Myb domain
PfamPF143792.3E-21287333IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MNSHSLWSID GGNTPCSSSS LSPLHNFLNL HPTETTTTSF QFKPSRHFSN GSFSRSSAFC  60
NLSSSSSSDT QKHLGTTLPF LSNPSTERSP AAASFSEEDL LSIPYEEEVD TSFLSLHGDG  120
GLQDLDNFSL SEEQMALQFL SDELQLAITD RAQTPRLDEI YQVTGSSPGQ KCIPSAMPVL  180
SQQPSPGGTE AVNQKPRMRW SPELHDCFLE AVKKLDGPEK ATPKAVMKMM SVEGLTIYQV  240
KSHLQKYRIA KHMPERKEEK KSGGNPEEKK PASNTNGEAN GRKKGAIQLT EALRMQMEVQ  300
KQLHQQLEVQ RSLQLRIEEH AKYLEKILDE QRKSTSKQDD ECETSLKRPR LEN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013710505.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A078JPH10.0A0A078JPH1_BRANA; BnaCnng55690D protein
STRINGBra038033.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1913667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-105G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]